Loading ...

Fast insight into nanotechnology

Access easily searchable nanoscience data, synthesis methods and literature

cholesteryl pullulan nanogel-long peptide antigen complex

Based on

1 Articles
2014 Most recent source

Composition

1

cholesteryl pullulan nanogel

CHP nanogel
Type Nano Material
Formula
Role carriers
2

NDHIAYFLYQILRGLQYIHSANVLHRDLKPSNLLLNT

MAGE-A4 long peptide antigen MAGE-A4 LPA
Type Biomolecule
Formula
Role loaded material

Properties

General physical and chemical properties

Property Value Nanomaterial Variant Source
Zeta potential

More information available to subscribers only.

Or, view sample content

Applications

Area Application Nanomaterial Variant Source
medicine/veterinary

More information available to subscribers only.

Or, view sample content

Characterization

Method Nanomaterial Variant Source
dynamic light scattering

More information/entries available to subscribers only.

Or, view sample content

Biological effects

Biological system Test details Nanomaterial Variant Source
BALB/c mouse

More information/entries available to subscribers only.

Or, view sample content

Preparation

References

Full content is available to subscribers only

To view content please choose from the following:

We use cookies to improve your experience with our site. More information

Sign up for a free trial