Fast insight into nanotechnology

Access easily searchable nanoscience data, synthesis methods and literature

cholesteryl pullulan nanogel-long peptide antigen complex

Based on

1 Articles
2014 Most recent source

Composition

1

cholesteryl pullulan nanogel

CHP nanogel
Type Nano Material
Formula
Role carriers
2

NDHIAYFLYQILRGLQYIHSANVLHRDLKPSNLLLNT

MAGE-A4 long peptide antigen MAGE-A4 LPA
Type Biomolecule
Formula
Role loaded material

Properties

General physical and chemical properties

Property Value Source
Zeta potential

More information available to subscribers only.

Or, view sample content

Applications

Area Application Source
medicine/veterinary

More information available to subscribers only.

Or, view sample content

Characterization

Method Source
dynamic light scattering

More information available to subscribers only.

Or, view sample content

Biological effects

Biological system Test details Source
BALB/c mouse

More information available to subscribers only.

Or, view sample content

Preparation

References

Full content is available to subscribers only

To view content please choose from the following:

We use cookies to improve your experience with our site. More information

Sign up for a free trial